PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA10G16300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 214aa    MW: 21281.6 Da    PI: 9.2702
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA10G16300.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof104.84.9e-3353109561
           zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                       ++cprC s+ntkfCyynnys +qPry+CkaCrr+Wt+GG+lr+vPvGggr+++k++
  ONIVA10G16300.1  53 PRQCPRCGSANTKFCYYNNYSRTQPRYLCKACRRHWTEGGTLRDVPVGGGRKNSKRA 109
                      679***********************************************9998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088426.46854108IPR003851Zinc finger, Dof-type
PfamPF027012.0E-3054108IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105692IPR003851Zinc finger, Dof-type
ProDomPD0074786.0E-176199IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MVFDDDLGVQ GQGYAAAANG GIGGGGVEAV NAAAAPRQGG RHAGHPPLPR PPPRQCPRCG  60
SANTKFCYYN NYSRTQPRYL CKACRRHWTE GGTLRDVPVG GGRKNSKRAA GGGKAGATAS  120
TAASAHVVAP AAAPPTSSSF PDLLRQMLMA PATAGGGGGY SIDLTAWQQM AAFAAPPQAA  180
TGDVGGAVGA ASTAAPDANC GGGGVQYWNG TNGD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0924890.0AC092489.4 Oryza sativa chromosome 10 BAC OSJNBa0066I08 genomic sequence, complete sequence.
GenBankAP0149660.0AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015614315.11e-139PREDICTED: dof zinc finger protein DOF3.1
TrEMBLA0A0E0IUN41e-152A0A0E0IUN4_ORYNI; Uncharacterized protein
STRINGLOC_Os10g35300.21e-147(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.34e-18Dof family protein